Antibodies

View as table Download

Rabbit polyclonal antibody to p21-ARC (actin related protein 2/3 complex, subunit 3, 21kDa)

Applications IHC, WB
Reactivities Human (Predicted: Pig, Rhesus Monkey, Bovine)
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 178 of p21-ARC (Uniprot ID#O15145)

p21 ARC (ARPC3) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human ARPC3

Rabbit Polyclonal Anti-ARPC3 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the N terminal of human ARPC3. Synthetic peptide located within the following region: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK

Rabbit Polyclonal Anti-ARPC3 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the middle region of human ARPC3. Synthetic peptide located within the following region: ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP