Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ACTR3 antibody
| Applications | WB |
| Reactivities | Human Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ACTR3. |
Arp3 (ACTR3) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ACTR3 |
Anti-ACTR3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 210 amino acids of human ARP3 actin-related protein 3 homolog (yeast) |
Rabbit Polyclonal Anti-ACTR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTR3 antibody: synthetic peptide directed towards the N terminal of human ACTR3. Synthetic peptide located within the following region: IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE |
ACTR3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human ACTR3 |
Active filters
Target Symbol
- ACTR3
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal