Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CAB39 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAB39 antibody: synthetic peptide directed towards the middle region of human CAB39. Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP |
Rabbit Polyclonal Anti-CAB39 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CAB39 |
CAB39 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human CAB39 (NP_001124321.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CAB39
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal