Rabbit Polyclonal Anti-CD99L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD99L2 antibody: synthetic peptide directed towards the middle region of human CD99L2. Synthetic peptide located within the following region: RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG |
CD99L2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD99L2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China