Antibodies

View as table Download

Rabbit Polyclonal antibody to CTDSP2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 26 and 271 of CTDSP2 (Uniprot ID#O14595)

CTDSP2 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human CTDSP2.

Rabbit Polyclonal Anti-CTDSP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the N terminal of human CTDSP2. Synthetic peptide located within the following region: MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV

Rabbit Polyclonal Anti-CTDSP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the middle region of human CTDSP2. Synthetic peptide located within the following region: ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA