Antibodies

View as table Download

Rabbit Polyclonal Anti-DMRT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the N terminal of human DMRT2. Synthetic peptide located within the following region: DPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDD

Rabbit Polyclonal anti-DMRT2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the N terminal of human DMRT2. Synthetic peptide located within the following region: RWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNFERKAV

Rabbit polyclonal anti-DMRT2 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE