Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |
DNMT3A Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DNMT3A |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-DNMT3A antibody: mouse DNMT3 (DNA methyltransferase 3A), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein. |
DNMT3A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Central region of Human DNMT3A |
DNMT3A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 871-900 amino acids from the C-terminal region of Human DNMT3A. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against synthetic peptides corresponding to areas around amino acids 125-175 and another around 175-225 of Dnmt3a. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 10-50 of human Dnmt3a was used as the immunogen. |
Anti-DNMT3A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNMT3A |
DNMT3A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNMT3A |
DNMT3A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A (NP_715640.2). |
| Modifications | Unmodified |
DNMT3A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A (NP_715640.2). |
DNMT3A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A (NP_715640.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
