Rabbit Polyclonal Anti-EGR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGR2 Antibody: A synthesized peptide derived from human EGR2 |
Rabbit Polyclonal Anti-EGR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGR2 Antibody: A synthesized peptide derived from human EGR2 |
EGR2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EGR2 |
Rabbit polyclonal EGR2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EGR2. |
Rabbit Polyclonal Anti-EGR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGR2 antibody: synthetic peptide directed towards the C terminal of human EGR2. Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG |
Rabbit Polyclonal EGR2 Antibody
Applications | WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a portion of human EGR2 (within residues 200-300). [Swiss-Prot# P11161] |
EGR2 (200-300) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGR2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EGR2 |
EGR2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EGR2 |
EGR2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EGR2 (NP_000390.2). |
Modifications | Unmodified |
EGR2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EGR2 (NP_000390.2). |
Modifications | Unmodified |
EGR2 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human EGR1/2. AA range:371-420 |