Rabbit anti-FES Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FES |
Rabbit anti-FES Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FES |
Rabbit Polyclonal FES Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal anti-FES antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FES. |
FES rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-FES Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FES antibody: synthetic peptide directed towards the N terminal of human FES. Synthetic peptide located within the following region: ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL |
Rabbit Polyclonal Anti-FES Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FES |
FES Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
FES rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FES |