Antibodies

Jump to Filters
View as table Download
HS6ST3 Rabbit Polyclonal Antibody
TA330988

USD 375.00

5 Days

Rabbit polyclonal Anti-HS6ST3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HS6ST3 antibody: synthetic peptide directed towards the C terminal of human HS6ST3. Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
HS6ST3 Rabbit Polyclonal Antibody
TA356765

USD 360.00

5 Days

HS6ST3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human H6ST3