Rabbit Polyclonal Anti-IL17D Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL17D antibody: synthetic peptide directed towards the N terminal of human IL17D. Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV |
IL17D rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Human IL-17D. |
IL17D rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Human IL-17D. |
IL17D rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human IL-17D. |
IL17D rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human IL-17D. |
IL17D (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the C-terminal region of Human IL17D |
Germany
Japan
United Kingdom
China
