MEPE (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 26-56 amino acids from the N-terminal region of human MEPE |
MEPE (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 26-56 amino acids from the N-terminal region of human MEPE |
Rabbit Polyclonal Anti-MEPE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MEPE antibody: synthetic peptide directed towards the middle region of human MEPE. Synthetic peptide located within the following region: LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEI |
MEPE Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MEPE |
MEPE Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic Peptide of human MEPE |
Modifications | Unmodified |