Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKBIB |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
| Modifications | Phospho-specific |
Rabbit Polyclonal IkappaB-beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IkappaB-beta |
Rabbit Polyclonal I kappaB- beta (Thr19) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Threonine 19 |
| Modifications | Phospho-specific |
Rabbit Polyclonal I kappaB- beta (Ser23) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Serine 23 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |
IKB beta (NFKBIB) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Rabbit polyclonal anti-IKB beta antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IkBb peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the middle region of human NFKBIB. Synthetic peptide located within the following region: PILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRS |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: DLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVCA |
IKB beta Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human IKB beta |
IκB-β (Phospho-S23) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human IκB-β around the phosphorylation site of Serine 23. |
Active filters
Target Symbol
- NFKBIB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Filter by
Category
Reactivities
Isotypes
Conjugates
Modifications
Pathways
- Adipocytokine signaling pathway (13)
- B cell receptor signaling pathway (13)
- Chemokine signaling pathway (13)
- Cytosolic DNA-sensing pathway (13)
- NOD-like receptor signaling pathway (13)
- Neurotrophin signaling pathway (13)
- RIG-I-like receptor signaling pathway (13)
- T cell receptor signaling pathway (13)