OR5L2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human OR5L2 |
OR5L2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human OR5L2 |
Rabbit Polyclonal Anti-OR5L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR5L2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5L2. Synthetic peptide located within the following region: YCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKALRKVMGSK |