Antibodies

View as table Download

Rabbit polyclonal Anti-P2X4 Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KKYKYVEDYEQGLSGEMNQ, corresponding to amino acid residues 370-388 of rat P2X4 Receptor? . Intracellular, C-terminus.

Rabbit Polyclonal Anti-P2RX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX4 antibody: synthetic peptide directed towards the N terminal of human P2RX4. Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW

P2RX4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-338 of human P2RX4 (NP_002551.2).
Modifications Unmodified