Antibodies

Jump to Filters
View as table Download
RFX2 Rabbit Polyclonal Antibody
TA314441

USD 345.00

In Stock

Rabbit polyclonal anti-RFX2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RFX2.
RFX2 (C-term) Rabbit Polyclonal Antibody
AP53643PU-N

USD 450.00

2 Weeks

RFX2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 676-706 amino acids from the C-terminal region of Human RFX2.
RFX2 Rabbit Polyclonal Antibody
TA335180

USD 375.00

5 Days

Rabbit Polyclonal Anti-RFX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX2 antibody: synthetic peptide directed towards the middle region of human RFX2. Synthetic peptide located within the following region: NDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQG
RFX2 Rabbit Polyclonal Antibody
TA380877

USD 220.00

3 Weeks

RFX2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 295-450 of human RFX2 (NP_000626.2).
Modifications Unmodified