Rabbit Polyclonal Anti-NULP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NULP1 antibody is: synthetic peptide directed towards the N-terminal region of Human NULP1. Synthetic peptide located within the following region: DLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNNRFELINIDDLEDDPVV |
Rabbit Polyclonal antibody to NULP1 (transcription factor 25 (basic helix-loop-helix))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 427 and 676 of NULP1 (Uniprot ID#Q9BQ70) |
Rabbit polyclonal TCF25 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TCF25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the N-terminal region of human TCF25. |
Rabbit Polyclonal Anti-TCF25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF25 antibody: synthetic peptide directed towards the N terminal of human TCF25. Synthetic peptide located within the following region: HRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTWLTTPKSTWPRYSK |
Rabbit Polyclonal Anti-TCF25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF25 antibody: synthetic peptide directed towards the N terminal of human TCF25. Synthetic peptide located within the following region: SGKLRKKKKKQKNKKSSTGEASENGLEDIDRILERIEDSTGLNRPGPAPL |
TCF25 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TCF25 |
TCF25 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TCF25 (NP_055787.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
