Rabbit Polyclonal Anti-TIA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the N terminal of human TIA1. Synthetic peptide located within the following region: MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED |
Rabbit Polyclonal Anti-TIA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the C terminal of human TIA1. Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ |
TIA1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
TIA1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human TIA1 (NP_071505.2). |
| Modifications | Unmodified |
TIA1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TIA1 (NP_071505.2). |
| Modifications | Unmodified |
TIA1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human TIA1 (NP_071505.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
