Antibodies

View as table Download

Rabbit polyclonal anti-TNFSF15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TNFSF15.

TL1A (TNFSF15) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 155-183 amino acids from the Central region of human TNFSF15

Biotinylated Anti-Human TL-1A Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TL-1A

Anti-Human TL-1A Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TL-1A

Rabbit Polyclonal anti-TNFSF15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP

Rabbit Polyclonal Anti-TNFSF15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF15

TNFSF15 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TNFSF15

TNFSF15 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF15