Antibodies

Jump to Filters
View as table Download
beta IV Tubulin (TUBB4A) Rabbit Polyclonal Antibody
TA340088

USD 375.00

5 Days

Rabbit Polyclonal Anti-TUBB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB4 antibody: synthetic peptide directed towards the N terminal of human TUBB4. Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI
beta IV Tubulin (TUBB4A) Rabbit Polyclonal Antibody
TA308381

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to beta Tubulin 4 (tubulin, beta 4)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 238 and 410 of beta Tubulin 4