Antibodies

Jump to Filters
View as table Download
PPP4R2 Rabbit Polyclonal Antibody
TA316171

USD 345.00

In Stock

Rabbit polyclonal anti-PP4R2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PP4R2.
PPP4R2 Rabbit Polyclonal Antibody
TA329514

USD 375.00

5 Days

Rabbit Polyclonal anti-PPP4R2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP4R2 antibody: synthetic peptide directed towards the C terminal of human PPP4R2. Synthetic peptide located within the following region: DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE