Rabbit polyclonal anti-Clock antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Clock. |
Rabbit polyclonal anti-Clock antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Clock. |
Rabbit Polyclonal Anti-Clock Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock |
Rabbit Polyclonal Anti-CLOCK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK. Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN |
Rabbit anti-CLOCK polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |