Antibodies

View as table Download

Rabbit Polyclonal Anti-ARHGAP20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGAP20 antibody: synthetic peptide directed towards the middle region of human ARHGAP20. Synthetic peptide located within the following region: YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK

Rabbit Polyclonal ARHGAP20 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 570-620 of human ARHGAP20 was used as the immunogen.