Antibodies

Jump to Filters
View as table Download
ARP10 (APOBEC3H) Rabbit Polyclonal Antibody
TA337730

USD 375.00

5 Days

Rabbit Polyclonal Anti-APOBEC3H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC3H antibody is: synthetic peptide directed towards the C-terminal region of Human APOBEC3H. Synthetic peptide located within the following region: SQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLE
ARP10 (APOBEC3H) Rabbit Polyclonal Antibody
TA362672

USD 360.00

5 Days

APOBEC3H Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of Human APOBEC3H