Antibodies

View as table Download

Rabbit Polyclonal Anti-CCRL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCRL2 antibody: synthetic peptide directed towards the N terminal of human CCRL2. Synthetic peptide located within the following region: LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL

Recombinant Anti-CCRL2 (Clone BZ5B8)

Applications ELISA, FC, ICC, IHC, IP, WB
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CCRL2 (Clone BZ2E3)

Applications ELISA, FC, ICC, IHC, IP, WB
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.