Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit polyclonal anti-CD40 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Rabbit anti CD40 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CD40 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD40 |
| Modifications | Unmodified |
CD40 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CD40 |
| Modifications | Unmodified |
Recombinant Anti-CD40 (Clone G28.5)
| Applications | FC, IHC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD79a (Clone ZL7-4)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40 (Clone A54 scFv)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40 (Clone 5D12)
| Applications | ELISA, FC, IHC, IP |
| Reactivities | Human, Monkey, Cynomolgus |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40 (Clone 3/23)
| Applications | FC, IHC, IP |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40 (Clone FGK45)
| Applications | FC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- CD40
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Filter by
Category
Reactivities
Isotypes
Clonalities
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (2)
- Unmodified (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (1)