Antibodies

Jump to Filters
View as table Download
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA313625

USD 345.00

In Stock

Rabbit polyclonal anti-CKM / M-CK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346079

USD 475.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346080

USD 475.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA321403

USD 345.00

In Stock

Anti-CKM Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA374825

USD 220.00

3 Weeks

CKM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-381 of human CKM (NP_001815.2).
Modifications Unmodified