Antibodies

Jump to Filters
View as table Download
CNN2 Rabbit Polyclonal Antibody
TA312947

USD 345.00

In Stock

Rabbit polyclonal anti-CNN2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNN2.
CNN2 Rabbit Polyclonal Antibody
TA340047

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF
CNN2 Rabbit Polyclonal Antibody
TA340048

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC
CNN2 Rabbit Polyclonal Antibody
TA370000

USD 380.00

4 Weeks

CNN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CNN2