Antibodies

View as table Download

GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%).

Rabbit Polyclonal EBI2/GPR183 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 300-350 of human EBI2 was used as the immunogen.

Rabbit Polyclonal Anti-GPR183 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR183 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR183. Synthetic peptide located within the following region: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK