Antibodies

Jump to Filters
View as table Download
IL17D Rabbit Polyclonal Antibody
TA344634

USD 475.00

5 Days

Rabbit Polyclonal Anti-IL17D Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL17D antibody: synthetic peptide directed towards the N terminal of human IL17D. Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV
IL17D Rabbit Polyclonal Antibody
TA351282

USD 345.00

In Stock

Rabbit Polyclonal Anti-IL17D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17D