KCNA10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA10 |
KCNA10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA10 |
Rabbit Polyclonal Anti-KCNA10 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW |
Rabbit Polyclonal Anti-KCNA10 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI |
Rabbit Polyclonal Anti-KV1.8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KDPETLLPTNDIHCR, corresponding to amino acid residues 187- 200 of human KV1.8. Intracellular, N-terminus. |
KCNA10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA10 |
KCNA10 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human KCNA10 (NP_005540.1). |
Modifications | Unmodified |