Antibodies

Jump to Filters
View as table Download
LGALS3BP Rabbit Polyclonal Antibody
TA335096

USD 375.00

5 Days

Rabbit Polyclonal Anti-LGALS3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS3BP antibody: synthetic peptide directed towards the middle region of human LGALS3BP. Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
LGALS3BP Rabbit Polyclonal Antibody
TA350135

USD 345.00

In Stock

Rabbit Polyclonal Anti-LGALS3BP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LGALS3BP
LGALS3BP Rabbit Polyclonal Antibody
TA378007

USD 220.00

3 Weeks

LGALS3BP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-221 of human LGALS3BP (NP_005558.1).
Modifications Unmodified