Rabbit Polyclonal Anti-LRRC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the N terminal of human LRRC6. Synthetic peptide located within the following region: LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL |
Rabbit Polyclonal Anti-LRRC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the middle region of human LRRC6. Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE |
Germany
Japan
United Kingdom
China