Rabbit Polyclonal Anti-MEPE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MEPE antibody: synthetic peptide directed towards the middle region of human MEPE. Synthetic peptide located within the following region: LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEI |
MEPE Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MEPE |
MEPE Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human MEPE |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China