Antibodies

Jump to Filters
View as table Download
NLE1 Rabbit Polyclonal Antibody
TA315525

USD 345.00

In Stock

Rabbit polyclonal anti-NLE1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NLE1.
Nle1 Rabbit Polyclonal Antibody
TA337898

USD 375.00

5 Days

Rabbit Polyclonal Anti-Nle1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Nle1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nle1. Synthetic peptide located within the following region: FTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWD
NLE1 Rabbit Polyclonal Antibody
TA338041

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLE1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLE1. Synthetic peptide located within the following region: DSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR
NLE1 Rabbit Polyclonal Antibody
TA379148

USD 220.00

3 Weeks

NLE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 268-353 of human NLE1 (NP_060566.2).
Modifications Unmodified