Rabbit Polyclonal Anti-NPEPL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPEPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human NPEPL1. Synthetic peptide located within the following region: HAGERATGFGVALLLALFGRASEDPLLNLVSPLGCEVDVEEGDLGRDSKR |
Rabbit Polyclonal Anti-NPEPL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPEPL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPEPL1. Synthetic peptide located within the following region: CIVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQD |
NPEPL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NPEPL1 |
NPEPL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 374-523 of human NPEPL1 (NP_078939.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China