Rabbit anti-PDLIM5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDLIM5 |
Rabbit anti-PDLIM5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDLIM5 |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: RTGTTQSRSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVAST |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: VKIPPKRPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQS |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the N terminal of human PDLIM5. Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the C terminal of human PDLIM5. Synthetic peptide located within the following region: AGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF |
PDLIM5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDLIM5 |
PDLIM5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDLIM5 |