SLC44A2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC44A2 |
SLC44A2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC44A2 |
Rabbit Polyclonal Anti-SLC44A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC44A2 Antibody is: synthetic peptide directed towards the middle region of Human SLC44A2. Synthetic peptide located within the following region: IMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLGFQTDFRVY |
SLC44A2 / CTL2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Human, Monkey, Orang-Utan, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | SLC44A2 / CTL2 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLC44A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago (94%); Bat (88%); Rat, Hamster, Elephant, Panda, Dog (81%). |
Rabbit Polyclonal Anti-SLC44A2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC44A2 |
SLC44A2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC44A2 (NP_065161.3). |
Modifications | Unmodified |