Rabbit polyclonal Anti-SULT1C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT1C2 antibody: synthetic peptide directed towards the C terminal of human SULT1C2. Synthetic peptide located within the following region: LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
Sult1c2 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
SULT1C2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SULT1C2 (NP_001047.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China