Antibodies

View as table Download

TM9SF4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen TM9SF4 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Panda (87%); Opossum (80%).

Rabbit Polyclonal Anti-TM9SF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TM9SF4 antibody: synthetic peptide directed towards the N terminal of human TM9SF4. Synthetic peptide located within the following region: HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR