Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF322A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF322A antibody: synthetic peptide directed towards the C terminal of human ZNF322A. Synthetic peptide located within the following region: YTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS

Rabbit Polyclonal Anti-ZNF322A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF322A antibody: synthetic peptide directed towards the N terminal of human ZNF322A. Synthetic peptide located within the following region: RTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHL

ZNF322 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF322