Antibodies

Jump to Filters
View as table Download
PIAS1 Rabbit Polyclonal Antibody
TA345192

USD 475.00

5 Days

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL
PIAS1 Rabbit Polyclonal Antibody
TA326261

USD 345.00

In Stock

Rabbit polyclonal PIAS1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS1.
PIAS1 Rabbit Polyclonal Antibody
TA345191

USD 475.00

5 Days

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS
PIAS1 Rabbit Polyclonal Antibody
TA347662

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 Antibody: A synthesized peptide derived from human PIAS1
PIAS1 Rabbit Polyclonal Antibody
TA319754

USD 430.00

5 Days

Rabbit Polyclonal PIAS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human PIAS1.
PIAS1 Rabbit Polyclonal Antibody
TA350894

USD 345.00

In Stock

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS1