Rabbit Polyclonal DR3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR3 antibody was raised against a peptide corresponding to amino acids in extracellular domain of human DR3 precusor. The immunogen is located within amino acids 50 - 100 of DR3. |
Rabbit Polyclonal DR3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DR3 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human DR3. The immunogen is located within the last 50 amino acids of DR3. |
Rabbit Polyclonal Anti-TNFRSF25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF25 antibody: synthetic peptide directed towards the middle region of human TNFRSF25. Synthetic peptide located within the following region: GRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP |
Anti-TNFRSF25 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 221-417 amino acids of human tumor necrosis factor receptor superfamily, member 25 |
Germany
Japan
United Kingdom
China
