Antibodies

Jump to Filters
View as table Download
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA314995

USD 345.00

In Stock

Rabbit polyclonal anti-TNFSF15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TNFSF15.
TL1A (TNFSF15) (Center) Rabbit Polyclonal Antibody
AP54314PU-N

USD 450.00

2 Weeks

TL1A (TNFSF15) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 155-183 amino acids from the Central region of human TNFSF15
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA328450

USD 285.00

5 Days

Biotinylated Anti-Human TL-1A Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TL-1A
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA328451

USD 285.00

5 Days

Anti-Human TL-1A Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TL-1A
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA329162

USD 375.00

5 Days

Rabbit Polyclonal anti-TNFSF15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA351829

USD 345.00

In Stock

Rabbit Polyclonal Anti-TNFSF15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF15