Antibodies

Jump to Filters
View as table Download
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA332763

USD 275.00

3 Weeks

Rabbit anti-ASNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ASNS
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA342876

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASNS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA349668

USD 345.00

In Stock

Rabbit Polyclonal Anti-ASNS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASNS