Antibodies

Jump to Filters
View as table Download
ATP6V1A (Center) Rabbit Polyclonal Antibody
AP50305PU-N

USD 450.00

2 Weeks

ATP6V1A (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 447~477 amino acids from the Central region of human ATP6V1A
ATP6V1A Rabbit Polyclonal Antibody
TA337648

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A. Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR