Antibodies

View as table Download

Rabbit Polyclonal CBFb Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBFb antibody: human CBFb (core-binding factor, beta subunit) using two KLH-conjugated synthetic peptides containing sequences from the central region of the protein.

Rabbit anti-CBFB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CBFB

Rabbit polyclonal CBFB Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CBFB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from the Central region of human CBFB.

Rabbit polyclonal anti-CBF beta antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBF β.

CBFB rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-PPP4R1L antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP4R1L.

Rabbit Polyclonal anti-CBFB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBFB antibody is: synthetic peptide directed towards the N-terminal region of Human CBFB. Synthetic peptide located within the following region: MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRD