Antibodies

Jump to Filters
View as table Download
CHFR Rabbit Polyclonal Antibody
TA329877

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHFR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHFR antibody: synthetic peptide directed towards the N terminal of human CHFR. Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN
CHFR Rabbit Polyclonal Antibody
TA315604

USD 345.00

4 Weeks

Rabbit polyclonal anti-CHFR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CHFR.