Antibodies

Jump to Filters
View as table Download
PSD93 (DLG2) Rabbit Polyclonal Antibody
TA332138

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLG2 Antibody: synthetic peptide directed towards the N terminal of human DLG2. Synthetic peptide located within the following region: MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS
PSD93 (DLG2) Rabbit Polyclonal Antibody
TA351561

USD 345.00

In Stock

Rabbit Polyclonal Anti-DLG2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLG2