Antibodies

Jump to Filters
View as table Download
RAI3 (GPRC5A) Rabbit Polyclonal Antibody
TA314849

USD 345.00

2 Weeks

Rabbit polyclonal anti-GPRC5A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPRC5A.
RAI3 (GPRC5A) Rabbit Polyclonal Antibody
TA346102

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPCR5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPCR5A antibody: synthetic peptide directed towards the C terminal of human GPCR5A. Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
RAI3 (GPRC5A) Rabbit Polyclonal Antibody
TA341052

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPRC5A Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen GPRC5A / RAI3 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human GPRC5A / RAI3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Bat, Dog, Panda (94%); Marmoset, Bovine (88%); Hamster, Rabbit, Opossum (81%).